Compound record
Teriparatide
PTH(1–34); human parathyroid hormone 1–34
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Length counts residues; formula and mass are the stored free-base values from cited sources; CAS and PubChem identify the substance in public registries. More detail: length & peptide bonds, molecular weight
Structure & modifications
Linear 34-mer with two methionines. Amphipathic helix in the receptor-bound state.
Notes
Teriparatide is recombinant human PTH(1–34) — the N-terminal fragment that retains PTH1-receptor agonism of full-length PTH(1–84).
It is linear and unmodified, with two methionines that can oxidize during careless handling. Amphipathic helix matters for receptor binding but is not a covalent classification flag.
| Property | Value |
|---|---|
| Length | 34 |
| Disulfide / amide | None on this record |
| CAS / PubChem | 52232-67-4 / 16129656 |
| Precursor | UniProt P01270 |
Full-length PTH(1–84) and other truncations are different entities — do not reuse this CAS.
Primary-source references
- PubChem CID 16129656 — teriparatide
- UniProt P01270 (parathyroid hormone)
- Potts J.T. et al. Synthesis of a biologically active N-terminal tetratriacontapeptide of parathyroid hormone. Proc. Natl. Acad. Sci. USA 1971.