Compound record

Exenatide

Exendin-4; AC2993

Linear C-terminal amidation

Sequence

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Length 39 residues
Formula C184H282N50O60S elemental composition
Molecular weight 4,186.61 g/mol · average mass
CAS number 141758-74-9 registry ID
PubChem CID 45588096 PubChem ID

Length counts residues; formula and mass are the stored free-base values from cited sources; CAS and PubChem identify the substance in public registries. More detail: length & peptide bonds, molecular weight

Structure & modifications

Linear 39-mer, C-terminal serine amide. Helical C-terminal cassette (PSSGAPPPS) is characteristic of exendin-4.

Notes

Exenatide is synthetic exendin-4, a 39-residue GLP-1 receptor agonist originally isolated from Heloderma suspectum venom.

  • Gly2 (vs Ala2 in human GLP-1) contributes to DPP-4 resistance
  • C-terminus is amidated
  • Characteristic helical cassette PSSGAPPPS is absent from native GLP-1
PropertyValue
Length39
TopologyLinear + C-terminal amide
CAS / PubChem141758-74-9 / 45588096
MW (record)4186.61

Lipidated human-GLP-1 analogues (liraglutide, semaglutide) are separate chemical entities with different CAS numbers — do not treat coded research-supply names as automatic equivalents.

Primary-source references

  • PubChem CID 45588096 — exenatide
  • Eng J. et al. Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. J. Biol. Chem. 1992.

Browse compounds Nulife catalog View on PubChem