Compound record
Exenatide
Exendin-4; AC2993
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Length counts residues; formula and mass are the stored free-base values from cited sources; CAS and PubChem identify the substance in public registries. More detail: length & peptide bonds, molecular weight
Structure & modifications
Linear 39-mer, C-terminal serine amide. Helical C-terminal cassette (PSSGAPPPS) is characteristic of exendin-4.
Notes
Exenatide is synthetic exendin-4, a 39-residue GLP-1 receptor agonist originally isolated from Heloderma suspectum venom.
- Gly2 (vs Ala2 in human GLP-1) contributes to DPP-4 resistance
- C-terminus is amidated
- Characteristic helical cassette PSSGAPPPS is absent from native GLP-1
| Property | Value |
|---|---|
| Length | 39 |
| Topology | Linear + C-terminal amide |
| CAS / PubChem | 141758-74-9 / 45588096 |
| MW (record) | 4186.61 |
Lipidated human-GLP-1 analogues (liraglutide, semaglutide) are separate chemical entities with different CAS numbers — do not treat coded research-supply names as automatic equivalents.
Primary-source references
- PubChem CID 45588096 — exenatide
- Eng J. et al. Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. J. Biol. Chem. 1992.