Compound record
Liraglutide
NN2211; Arg34-Lys26-(Nε-(γ-Glu(Nα-hexadecanoyl)))-GLP-1(7–37)
Sequence
HAEGTFTSDVSSYLEGQAAK(Nε-γ-Glu-palmitoyl)EFIAWLVRGRG
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Length counts residues; formula and mass are the stored free-base values from cited sources; CAS and PubChem identify the substance in public registries. More detail: length & peptide bonds, molecular weight
Structure & modifications
Linear backbone with a lipidated lysine. The 1-letter sequence does not encode the palmitoyl-γ-Glu side chain.
Notes
Liraglutide is a 31-residue analogue of human GLP-1(7–37) built for albumin binding: Arg34 replaces Lys34, and Lys26 carries palmitate via a γ-glutamyl spacer.
| Feature | How it appears here |
|---|---|
| Backbone | 1-letter GLP-1-like 31-mer |
| Lipidation | Display: K(Nε-γ-Glu-palmitoyl) |
| Modification tag | lipid-conjugation |
| CAS / PubChem | 204656-20-2 / 16134956 |
A naïve residue-mass sum of 31 amino acids will not match the recorded MW unless the palmitoyl-γ-Glu contribution is included. Compare with semaglutide (Aib8 + longer diacid linker).
Primary-source references
- PubChem CID 16134956 — liraglutide
- CAS 204656-20-2
- Knudsen L.B. et al. Potent derivatives of glucagon-like peptide-1 with pharmacokinetic properties suitable for once daily administration. J. Med. Chem. 2000.