Compound record

Calcitonin (salmon)

Salmon calcitonin; sCT

Cyclic C-terminal amidation Disulfide bridge

Sequence

CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (disulfide Cys1–Cys7)

CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

Length 32 residues
Formula C145H240N44O48S2 elemental composition
Molecular weight 3,431.85 g/mol · average mass
CAS number 47931-85-1 registry ID
PubChem CID 16129626 PubChem ID

Length counts residues; formula and mass are the stored free-base values from cited sources; CAS and PubChem identify the substance in public registries. More detail: length & peptide bonds, molecular weight

Structure & modifications

N-terminal disulfide ring plus a long amphipathic helix and a C-terminal proline amide.

Notes

Salmon calcitonin is the 32-residue reference calcitonin in many pharmacopeias. Human calcitonin differs at multiple positions and must not share this identity.

  • Cys1–Cys7 disulfide — N-terminal ring
  • C-terminal prolinamide
  • Long amphipathic mid-region supporting helix in membrane mimetics
FeatureValue
Length32
ClassificationCyclic (disulfide)
CAS / PubChem47931-85-1 / 16129626
Related architecturePramlintide (amylin analogue) shares a similar N-terminal ring style

Display notation must include -NH2 and the disulfide pair when reconciling formula with registry data.

Primary-source references

  • PubChem CID 16129626 — calcitonin salmon
  • Niall H.D. et al. Amino acid sequence of salmon ultimobranchial calcitonin. Proc. Natl. Acad. Sci. USA 1969.

Browse compounds Nulife catalog View on PubChem